APrEST72866-100ul, PrEST Antigen ERGIC3 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ERGIC3, Gene description: ERGIC and golgi 3, Alternative Gene Names: C20orf47, CGI-54, Erv46, NY-BR-84, PRO0989, SDBCAG84, Antigen sequence: CNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ERGIC3, Gene description: ERGIC and golgi 3, Alternative Gene Names: C20orf47, CGI-54, Erv46, NY-BR-84, PRO0989, SDBCAG84, Antigen sequence: CNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|