APrEST70550-100ul, PrEST Antigen ERH Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ERH, Gene description: enhancer of rudimentary homolog (Drosophila), Alternative Gene Names: DROER, Antigen sequence: LVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ERH, Gene description: enhancer of rudimentary homolog (Drosophila), Alternative Gene Names: DROER, Antigen sequence: LVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|