Limba
|
APrEST96232-100ul, PrEST Antigen MCTP1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen MCTP1, Gene description: multiple C2 and transmembrane domain containing 1, Alternative Gene Names: FLJ22344, Antigen sequence: MLDSCKLKSACNLPFICNKKIINTAGTSNAEVPLADPGMYQLDITLRRGQSLAARDRGGTSD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen MCTP1, Gene description: multiple C2 and transmembrane domain containing 1, Alternative Gene Names: FLJ22344, Antigen sequence: MLDSCKLKSACNLPFICNKKIINTAGTSNAEVPLADPGMYQLDITLRRGQSLAARDRGGTSD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|