Limba
|
APrEST95997-100ul, PrEST Antigen WDFY1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen WDFY1, Gene description: WD repeat and FYVE domain containing 1, Alternative Gene Names: FENS-1, KIAA1435, WDF1, ZFYVE17, Antigen sequence: VRVCDSCYDSIKDEDRTSLATFHEGKHNISHMSMDIARGLMVTCGTDRIVKI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen WDFY1, Gene description: WD repeat and FYVE domain containing 1, Alternative Gene Names: FENS-1, KIAA1435, WDF1, ZFYVE17, Antigen sequence: VRVCDSCYDSIKDEDRTSLATFHEGKHNISHMSMDIARGLMVTCGTDRIVKI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|