Limba
|
APrEST95638-100ul, PrEST Antigen AGFG2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen AGFG2, Gene description: ArfGAP with FG repeats 2, Alternative Gene Names: HRBL, RABR, Antigen sequence: MVMAAKKGPGPGGGVSGGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDITVGSFVCTTCSGLLRGLN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen AGFG2, Gene description: ArfGAP with FG repeats 2, Alternative Gene Names: HRBL, RABR, Antigen sequence: MVMAAKKGPGPGGGVSGGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDITVGSFVCTTCSGLLRGLN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|