APrEST95605-100ul, PrEST Antigen APPL2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen APPL2, Gene description: adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 2, Alternative Gene Names: DIP13B, FLJ10659, Antigen sequence: ELAKQLADTMVLPIIQFREKDLTEVSTLKDLFGLASNEHDLSMAKYSRLPKKKENEKVKTEVGKEVAAARRKQHLSSLQYYCALNALQYRKQMA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen APPL2, Gene description: adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 2, Alternative Gene Names: DIP13B, FLJ10659, Antigen sequence: ELAKQLADTMVLPIIQFREKDLTEVSTLKDLFGLASNEHDLSMAKYSRLPKKKENEKVKTEVGKEVAAARRKQHLSSLQYYCALNALQYRKQMA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|