Limba
|
APrEST95436-100ul, PrEST Antigen MOAP1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen MOAP1, Gene description: modulator of apoptosis 1, Alternative Gene Names: MAP-1, PNMA4, Antigen sequence: GEGMTVGELSRALGHENGSLDPEQGMIPEMWAPMLAQALEALQPALQCLKYKKLRVFSGRESPEPGEEEFGRWMF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen MOAP1, Gene description: modulator of apoptosis 1, Alternative Gene Names: MAP-1, PNMA4, Antigen sequence: GEGMTVGELSRALGHENGSLDPEQGMIPEMWAPMLAQALEALQPALQCLKYKKLRVFSGRESPEPGEEEFGRWMF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|