APrEST95431-100ul, PrEST Antigen SUN3 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SUN3, Gene description: Sad1 and UNC84 domain containing 3, Alternative Gene Names: MGC33329, SUNC1, Antigen sequence: KLREDQVEMADYALKSAGASIIEAGTSESYKNNKAKLYWHGIGFLNHEMPPDIILQPDVYPGKCWAFPGSQGHTLIKLATKIIPTAVTMEHISEKVSPSG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen SUN3, Gene description: Sad1 and UNC84 domain containing 3, Alternative Gene Names: MGC33329, SUNC1, Antigen sequence: KLREDQVEMADYALKSAGASIIEAGTSESYKNNKAKLYWHGIGFLNHEMPPDIILQPDVYPGKCWAFPGSQGHTLIKLATKIIPTAVTMEHISEKVSPSG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|