Limba
|
APrEST95426-100ul, PrEST Antigen FEZ1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen FEZ1, Gene description: fasciculation and elongation protein zeta 1, Alternative Gene Names: UNC-76, Antigen sequence: EEEVLEEEDGGETSSQADSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen FEZ1, Gene description: fasciculation and elongation protein zeta 1, Alternative Gene Names: UNC-76, Antigen sequence: EEEVLEEEDGGETSSQADSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|