Limba
|
APrEST95314-100ul, PrEST Antigen NWD1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen NWD1, Gene description: NACHT and WD repeat domain containing 1, Antigen sequence: ATVFLREIQDLHKHILEDCALRMVDRLADGCLDTDAQNLLSSLKSHITDMHPGVLKTHRLPWSRDLVNPKNKTHACYLKELGEQFVVRANHQVLT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen NWD1, Gene description: NACHT and WD repeat domain containing 1, Antigen sequence: ATVFLREIQDLHKHILEDCALRMVDRLADGCLDTDAQNLLSSLKSHITDMHPGVLKTHRLPWSRDLVNPKNKTHACYLKELGEQFVVRANHQVLT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|