APrEST95292-100ul, PrEST Antigen TOGARAM2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TOGARAM2, Gene description: TOG array regulator of axonemal microtubules 2, Alternative Gene Names: Crescerin-2, FAM179A, FLJ43249, LOC165186, Antigen sequence: FSNPELGLRDALQCLNSSDWQMKEKGLVSIQRLAACHSEVLTGKLHDVCLAVTGEVTNLRSKVSHLAISTLGDLFQALKKNMDQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen TOGARAM2, Gene description: TOG array regulator of axonemal microtubules 2, Alternative Gene Names: Crescerin-2, FAM179A, FLJ43249, LOC165186, Antigen sequence: FSNPELGLRDALQCLNSSDWQMKEKGLVSIQRLAACHSEVLTGKLHDVCLAVTGEVTNLRSKVSHLAISTLGDLFQALKKNMDQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|