APrEST95264-100ul, PrEST Antigen RMDN3 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen RMDN3, Gene description: regulator of microtubule dynamics 3, Alternative Gene Names: FAM82A2, FAM82C, FLJ10579, PTPIP51, RMD3, Antigen sequence: SQRWKRTQRHGRSQSLPNSLDYTQTSDPGRHVMLLRAVPGGAGDASVLPSLPREGQEKVLDRLDFVLTSLVALRREVEELRSSLRGLAGEIVGE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen RMDN3, Gene description: regulator of microtubule dynamics 3, Alternative Gene Names: FAM82A2, FAM82C, FLJ10579, PTPIP51, RMD3, Antigen sequence: SQRWKRTQRHGRSQSLPNSLDYTQTSDPGRHVMLLRAVPGGAGDASVLPSLPREGQEKVLDRLDFVLTSLVALRREVEELRSSLRGLAGEIVGE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|