Limba
|
APrEST95244-100ul, PrEST Antigen RGS1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen RGS1, Gene description: regulator of G protein signaling 1, Alternative Gene Names: 1R20, BL34, IER1, IR20, Antigen sequence: RSMIPHLESGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen RGS1, Gene description: regulator of G protein signaling 1, Alternative Gene Names: 1R20, BL34, IER1, IR20, Antigen sequence: RSMIPHLESGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|