APrEST95220-100ul, PrEST Antigen HERC2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen HERC2, Gene description: HECT and RLD domain containing E3 ubiquitin protein ligase 2, Alternative Gene Names: D15F37S1, jdf2, p528, Antigen sequence: AQVPMEYNHLQEIPIIALRNRLLLLHHLSELFCPCIPMFDLEGSLDETGLGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen HERC2, Gene description: HECT and RLD domain containing E3 ubiquitin protein ligase 2, Alternative Gene Names: D15F37S1, jdf2, p528, Antigen sequence: AQVPMEYNHLQEIPIIALRNRLLLLHHLSELFCPCIPMFDLEGSLDETGLGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|