APrEST95211-100ul, PrEST Antigen ZBTB18 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ZBTB18, Gene description: zinc finger and BTB domain containing 18, Alternative Gene Names: C2H2-171, RP58, TAZ-1, ZNF238, Antigen sequence: EDASSCSDKVESLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen ZBTB18, Gene description: zinc finger and BTB domain containing 18, Alternative Gene Names: C2H2-171, RP58, TAZ-1, ZNF238, Antigen sequence: EDASSCSDKVESLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|