Limba
|
APrEST95146-100ul, PrEST Antigen TIMM44 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TIMM44, Gene description: translocase of inner mitochondrial membrane 44, Alternative Gene Names: TIM44, Antigen sequence: TDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen TIMM44, Gene description: translocase of inner mitochondrial membrane 44, Alternative Gene Names: TIM44, Antigen sequence: TDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|