APrEST95043-100ul, PrEST Antigen RPRD1B Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen RPRD1B, Gene description: regulation of nuclear pre-mRNA domain containing 1B, Alternative Gene Names: C20orf77, CREPT, dJ1057B20.2, DKFZp434P0735, FLJ44520, K-H, Kub5-Hera, NET60, Antigen sequence: RLAAELEDRRQLARMLVEYTQNQKDVLSEKEKK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen RPRD1B, Gene description: regulation of nuclear pre-mRNA domain containing 1B, Alternative Gene Names: C20orf77, CREPT, dJ1057B20.2, DKFZp434P0735, FLJ44520, K-H, Kub5-Hera, NET60, Antigen sequence: RLAAELEDRRQLARMLVEYTQNQKDVLSEKEKK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|