Limba
|
APrEST95033-100ul, PrEST Antigen SFMBT2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SFMBT2, Gene description: Scm like with four mbt domains 2, Alternative Gene Names: KIAA1617, Antigen sequence: PERTRRGRGAPAASSAEEGEKCPPTKPEGTEDTKQEEEERLVLESNPLEWTVTDVVRFIKLTDC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SFMBT2, Gene description: Scm like with four mbt domains 2, Alternative Gene Names: KIAA1617, Antigen sequence: PERTRRGRGAPAASSAEEGEKCPPTKPEGTEDTKQEEEERLVLESNPLEWTVTDVVRFIKLTDC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|