APrEST94959-100ul, PrEST Antigen FCER2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen FCER2, Gene description: Fc fragment of IgE receptor II, Alternative Gene Names: CD23, CD23A, CLEC4J, FCE2, Antigen sequence: LKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen FCER2, Gene description: Fc fragment of IgE receptor II, Alternative Gene Names: CD23, CD23A, CLEC4J, FCE2, Antigen sequence: LKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|