APrEST94921-100ul, PrEST Antigen OBSCN Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen OBSCN, Gene description: obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF, Alternative Gene Names: ARHGEF30, KIAA1556, KIAA1639, UNC89, Antigen sequence: EVEETIEVRVKKMGPQGVSPTTEVPRSSSGHLFTLPGATPGGDPNSNNSNNKLLAQEAWAQGTAMVGVREPLVFRVDARGSVDWAASGMGS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen OBSCN, Gene description: obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF, Alternative Gene Names: ARHGEF30, KIAA1556, KIAA1639, UNC89, Antigen sequence: EVEETIEVRVKKMGPQGVSPTTEVPRSSSGHLFTLPGATPGGDPNSNNSNNKLLAQEAWAQGTAMVGVREPLVFRVDARGSVDWAASGMGS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|