APrEST94815-100ul, PrEST Antigen ANKS4B Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ANKS4B, Gene description: ankyrin repeat and sterile alpha motif domain containing 4B, Alternative Gene Names: FLJ38819, HARP, Antigen sequence: TFGSLSKGIKDTFKIKFKKNKDTAEQVGKEGRSGQRNVMEVFREEEEDSFSGDFKEKLQLSAEEDGSVHHESILNRPGLG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ANKS4B, Gene description: ankyrin repeat and sterile alpha motif domain containing 4B, Alternative Gene Names: FLJ38819, HARP, Antigen sequence: TFGSLSKGIKDTFKIKFKKNKDTAEQVGKEGRSGQRNVMEVFREEEEDSFSGDFKEKLQLSAEEDGSVHHESILNRPGLG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|