APrEST94599-100ul, PrEST Antigen ADAMTS2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ADAMTS2, Gene description: ADAM metallopeptidase with thrombospondin type 1 motif 2, Alternative Gene Names: ADAM-TS2, ADAMTS-3, hPCPNI, NPI, PCINP, Antigen sequence: IEPLEKGLAAQEAEQGRVHVVYRRPPTSPPLGGPQALDTGASLDSLDSLSRALGVLEEHANSSRRRARRHAADDDYNIEV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ADAMTS2, Gene description: ADAM metallopeptidase with thrombospondin type 1 motif 2, Alternative Gene Names: ADAM-TS2, ADAMTS-3, hPCPNI, NPI, PCINP, Antigen sequence: IEPLEKGLAAQEAEQGRVHVVYRRPPTSPPLGGPQALDTGASLDSLDSLSRALGVLEEHANSSRRRARRHAADDDYNIEV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|