APrEST94461-100ul, PrEST Antigen SESTD1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SESTD1, Gene description: SEC14 and spectrin domain containing 1, Alternative Gene Names: DKFZp434O0515, Solo, Antigen sequence: WNVVKTVVVMLQNVVPAEVSLVCVVKPDEFWDKKVTHFCFWKEKDRLGFEVILVSANKLTRYIEPCQLTEDFGGSL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SESTD1, Gene description: SEC14 and spectrin domain containing 1, Alternative Gene Names: DKFZp434O0515, Solo, Antigen sequence: WNVVKTVVVMLQNVVPAEVSLVCVVKPDEFWDKKVTHFCFWKEKDRLGFEVILVSANKLTRYIEPCQLTEDFGGSL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|