Limba
|
APrEST94454-100ul, PrEST Antigen ABT1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ABT1, Gene description: activator of basal transcription 1, Antigen sequence: SKKRVVPGIVYLGHIPPRFRPLHVRNLLSAYGEVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ABT1, Gene description: activator of basal transcription 1, Antigen sequence: SKKRVVPGIVYLGHIPPRFRPLHVRNLLSAYGEVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|