APrEST94416-100ul, PrEST Antigen PLEKHG3 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen PLEKHG3, Gene description: pleckstrin homology and RhoGEF domain containing G3, Alternative Gene Names: ARHGEF43, KIAA0599, Antigen sequence: SFESISSLPEVEPDPEAGSEQEVFSAVEGPSAEETPSDTESPEVLETQLDAHQGLLGMDPPGDMVDFVAA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen PLEKHG3, Gene description: pleckstrin homology and RhoGEF domain containing G3, Alternative Gene Names: ARHGEF43, KIAA0599, Antigen sequence: SFESISSLPEVEPDPEAGSEQEVFSAVEGPSAEETPSDTESPEVLETQLDAHQGLLGMDPPGDMVDFVAA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|