APrEST94399-100ul, PrEST Antigen CHFR Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CHFR, Gene description: checkpoint with forkhead and ring finger domains, Alternative Gene Names: FLJ10796, RNF196, Antigen sequence: AYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDISQPYVVCRQCPEYRR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen CHFR, Gene description: checkpoint with forkhead and ring finger domains, Alternative Gene Names: FLJ10796, RNF196, Antigen sequence: AYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDISQPYVVCRQCPEYRR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|