APrEST94247-100ul, PrEST Antigen ECSCR Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ECSCR, Gene description: endothelial cell surface expressed chemotaxis and apoptosis regulator, Alternative Gene Names: ARIA, ECSM2, Antigen sequence: SQPTMTQTSSSQGGLGGLSLTTEPVSSNPGYIPSSEANRPSHLSSTGT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen ECSCR, Gene description: endothelial cell surface expressed chemotaxis and apoptosis regulator, Alternative Gene Names: ARIA, ECSM2, Antigen sequence: SQPTMTQTSSSQGGLGGLSLTTEPVSSNPGYIPSSEANRPSHLSSTGT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|