APrEST94224-100ul, PrEST Antigen RC3H2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen RC3H2, Gene description: ring finger and CCCH-type domains 2, Alternative Gene Names: FLJ20301, FLJ20713, MNAB, RNF164, Antigen sequence: QKEPPKQKKQSLGEDHVILEEQKTILPVTSCFSQPLPVSISNASCLPITTSVSAGNLILKTHVMSEDKNDFLKPVANGKMV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen RC3H2, Gene description: ring finger and CCCH-type domains 2, Alternative Gene Names: FLJ20301, FLJ20713, MNAB, RNF164, Antigen sequence: QKEPPKQKKQSLGEDHVILEEQKTILPVTSCFSQPLPVSISNASCLPITTSVSAGNLILKTHVMSEDKNDFLKPVANGKMV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|