APrEST94208-100ul, PrEST Antigen LONRF3 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen LONRF3, Gene description: LON peptidase N-terminal domain and ring finger 3, Alternative Gene Names: FLJ22612, RNF127, Antigen sequence: MESVRIEQMLSLPAEVSSDNLESAERGASAAQVDMGPHPKVAAEGPAPLPTREPEQEQSPGTSTPESKVLLTQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen LONRF3, Gene description: LON peptidase N-terminal domain and ring finger 3, Alternative Gene Names: FLJ22612, RNF127, Antigen sequence: MESVRIEQMLSLPAEVSSDNLESAERGASAAQVDMGPHPKVAAEGPAPLPTREPEQEQSPGTSTPESKVLLTQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|