APrEST94166-100ul, PrEST Antigen UHRF1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen UHRF1, Gene description: ubiquitin like with PHD and ring finger domains 1, Alternative Gene Names: FLJ21925, ICBP90, Np95, RNF106, TDRD22, Antigen sequence: RARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen UHRF1, Gene description: ubiquitin like with PHD and ring finger domains 1, Alternative Gene Names: FLJ21925, ICBP90, Np95, RNF106, TDRD22, Antigen sequence: RARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|