APrEST94103-100ul, PrEST Antigen CIB1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CIB1, Gene description: calcium and integrin binding 1, Alternative Gene Names: CIB, KIP, SIP2-28, Antigen sequence: SGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen CIB1, Gene description: calcium and integrin binding 1, Alternative Gene Names: CIB, KIP, SIP2-28, Antigen sequence: SGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|