Limba
|
APrEST93345-100ul, PrEST Antigen ZBTB6 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ZBTB6, Gene description: zinc finger and BTB domain containing 6, Alternative Gene Names: ZID, ZNF482, Antigen sequence: EGSYGTVSEIQNLEEGYSLRHQCPRCPRGFLHVENYLRHLKMHKLFLCLQC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen ZBTB6, Gene description: zinc finger and BTB domain containing 6, Alternative Gene Names: ZID, ZNF482, Antigen sequence: EGSYGTVSEIQNLEEGYSLRHQCPRCPRGFLHVENYLRHLKMHKLFLCLQC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|