APrEST93340-100ul, PrEST Antigen LRFN2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen LRFN2, Gene description: leucine rich repeat and fibronectin type III domain containing 2, Alternative Gene Names: FIGLER2, KIAA1246, SALM1, Antigen sequence: PWRIPPSAPRPKPSLDRLMGAFASLDLKSQRKEELLDSRTPAGRGAGTSARGHHSDREPLL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen LRFN2, Gene description: leucine rich repeat and fibronectin type III domain containing 2, Alternative Gene Names: FIGLER2, KIAA1246, SALM1, Antigen sequence: PWRIPPSAPRPKPSLDRLMGAFASLDLKSQRKEELLDSRTPAGRGAGTSARGHHSDREPLL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|