Limba
|
APrEST93318-100ul, PrEST Antigen NHS Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen NHS, Gene description: Nance-Horan syndrome (congenital cataracts and dental anomalies), Antigen sequence: ATYDSFLEKSPSDKADTSSHFSVDTEGYYTSMHFDCGLKGNKSYVCHYAALGPENGQGVGASPGLPDCAWQDYLDHKRQGRPSISFRKP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen NHS, Gene description: Nance-Horan syndrome (congenital cataracts and dental anomalies), Antigen sequence: ATYDSFLEKSPSDKADTSSHFSVDTEGYYTSMHFDCGLKGNKSYVCHYAALGPENGQGVGASPGLPDCAWQDYLDHKRQGRPSISFRKP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|