APrEST93252-100ul, PrEST Antigen HEY2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen HEY2, Gene description: hes-related family bHLH transcription factor with YRPW motif 2, Alternative Gene Names: bHLHb32, HERP1, HESR2, Antigen sequence: PCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen HEY2, Gene description: hes-related family bHLH transcription factor with YRPW motif 2, Alternative Gene Names: bHLHb32, HERP1, HESR2, Antigen sequence: PCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|