Limba
|
APrEST93198-100ul, PrEST Antigen CUZD1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CUZD1, Gene description: CUB and zona pellucida-like domains 1, Alternative Gene Names: ERG-1, UO-44, Antigen sequence: SNGNNLQLKDPTCRPKLSNVVEFSVPLNGCGTIRKVEDQSITYTNIITFSASSTSEVITRQKQLQIIVKCEM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen CUZD1, Gene description: CUB and zona pellucida-like domains 1, Alternative Gene Names: ERG-1, UO-44, Antigen sequence: SNGNNLQLKDPTCRPKLSNVVEFSVPLNGCGTIRKVEDQSITYTNIITFSASSTSEVITRQKQLQIIVKCEM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|