Limba
|
APrEST93196-100ul, PrEST Antigen SOCS1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SOCS1, Gene description: suppressor of cytokine signaling 1, Alternative Gene Names: Cish1, JAB, SOCS-1, SSI-1, TIP3, Antigen sequence: LQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen SOCS1, Gene description: suppressor of cytokine signaling 1, Alternative Gene Names: Cish1, JAB, SOCS-1, SSI-1, TIP3, Antigen sequence: LQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|