Limba
|
APrEST93109-100ul, PrEST Antigen MPIG6B Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen MPIG6B, Gene description: megakaryocyte and platelet inhibitory receptor G6b, Alternative Gene Names: G6b, NG31, Antigen sequence: DRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen MPIG6B, Gene description: megakaryocyte and platelet inhibitory receptor G6b, Alternative Gene Names: G6b, NG31, Antigen sequence: DRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|