Limba
|
APrEST93108-100ul, PrEST Antigen SPSB4 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SPSB4, Gene description: splA/ryanodine receptor domain and SOCS box containing 4, Alternative Gene Names: SSB-4, Antigen sequence: QKLSGSLKSVEVREPALRPAKRELRGAEPGRPARLDQLLDMPAAGLAVQLRH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SPSB4, Gene description: splA/ryanodine receptor domain and SOCS box containing 4, Alternative Gene Names: SSB-4, Antigen sequence: QKLSGSLKSVEVREPALRPAKRELRGAEPGRPARLDQLLDMPAAGLAVQLRH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|