Limba
|
APrEST93010-100ul, PrEST Antigen DOCK4 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen DOCK4, Gene description: dedicator of cytokinesis 4, Alternative Gene Names: FLJ34238, KIAA0716, Antigen sequence: CSAIYPTPVEPSQRMLFNHIGDGALPRSDPNLSAPEKAVNPTPSSWSLDSGKEAKNMSDSGKLISP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen DOCK4, Gene description: dedicator of cytokinesis 4, Alternative Gene Names: FLJ34238, KIAA0716, Antigen sequence: CSAIYPTPVEPSQRMLFNHIGDGALPRSDPNLSAPEKAVNPTPSSWSLDSGKEAKNMSDSGKLISP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|