APrEST92990-100ul, PrEST Antigen MTOR Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen MTOR, Gene description: mechanistic target of rapamycin (serine/threonine kinase), Alternative Gene Names: FLJ44809, FRAP, FRAP1, FRAP2, RAFT1, RAPT1, Antigen sequence: TESLDSTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen MTOR, Gene description: mechanistic target of rapamycin (serine/threonine kinase), Alternative Gene Names: FLJ44809, FRAP, FRAP1, FRAP2, RAFT1, RAPT1, Antigen sequence: TESLDSTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|