Limba
|
APrEST92912-100ul, PrEST Antigen RGS19 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen RGS19, Gene description: regulator of G-protein signaling 19, Alternative Gene Names: GAIP, RGSGAIP, Antigen sequence: PHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen RGS19, Gene description: regulator of G-protein signaling 19, Alternative Gene Names: GAIP, RGSGAIP, Antigen sequence: PHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|