Limba
|
APrEST92828-100ul, PrEST Antigen CPSF1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CPSF1, Gene description: cleavage and polyadenylation specific factor 1, 160kDa, Antigen sequence: AISLNITQKVHPVIWSLTSLPFDCTQALAVPKPIGGVVVFAVNSLLYLNQSVPPYGVALNSLTTGTTAFPLRT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen CPSF1, Gene description: cleavage and polyadenylation specific factor 1, 160kDa, Antigen sequence: AISLNITQKVHPVIWSLTSLPFDCTQALAVPKPIGGVVVFAVNSLLYLNQSVPPYGVALNSLTTGTTAFPLRT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|