APrEST92715-100ul, PrEST Antigen PIAS3 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen PIAS3, Gene description: protein inhibitor of activated STAT, 3, Alternative Gene Names: FLJ14651, ZMIZ5, Antigen sequence: ITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPGGALREGHGGPLPSGPSLTGCRSDIISLD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen PIAS3, Gene description: protein inhibitor of activated STAT, 3, Alternative Gene Names: FLJ14651, ZMIZ5, Antigen sequence: ITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPGGALREGHGGPLPSGPSLTGCRSDIISLD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|