APrEST92663-100ul, PrEST Antigen AP4M1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen AP4M1, Gene description: adaptor-related protein complex 4, mu 1 subunit, Alternative Gene Names: MU-4, MU-ARP2, SPG50, Antigen sequence: SVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFES, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen AP4M1, Gene description: adaptor-related protein complex 4, mu 1 subunit, Alternative Gene Names: MU-4, MU-ARP2, SPG50, Antigen sequence: SVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFES, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|