APrEST92527-100ul, PrEST Antigen JAKMIP2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen JAKMIP2, Gene description: janus kinase and microtubule interacting protein 2, Alternative Gene Names: JAMIP2, KIAA0555, Antigen sequence: RETEKQCKPLLERNKCLAKRNDELMVSLQRMEEKLKAVTKENSEMREKITSHPPLKKLKSLNDLDQANEEQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen JAKMIP2, Gene description: janus kinase and microtubule interacting protein 2, Alternative Gene Names: JAMIP2, KIAA0555, Antigen sequence: RETEKQCKPLLERNKCLAKRNDELMVSLQRMEEKLKAVTKENSEMREKITSHPPLKKLKSLNDLDQANEEQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|