APrEST92488-100ul, PrEST Antigen SMARCA1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SMARCA1, Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1, Alternative Gene Names: hSNF2L, ISWI, NURF140, SNF2L, SNF2L1, SNF2LB, SWI, Antigen sequence: KGEKKKEKNVSSFQLKLAAKAPKSEKEMDPEYEEKMKADRAKRFEFLLKQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SMARCA1, Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1, Alternative Gene Names: hSNF2L, ISWI, NURF140, SNF2L, SNF2L1, SNF2LB, SWI, Antigen sequence: KGEKKKEKNVSSFQLKLAAKAPKSEKEMDPEYEEKMKADRAKRFEFLLKQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|