Limba
|
APrEST92255-100ul, PrEST Antigen AMN1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen AMN1, Gene description: antagonist of mitotic exit network 1 homolog, Antigen sequence: LTDGAVEAVLTYCPQIRILLFHGCPLITDHSREVLEQLVGPNKLKQVTWTVY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen AMN1, Gene description: antagonist of mitotic exit network 1 homolog, Antigen sequence: LTDGAVEAVLTYCPQIRILLFHGCPLITDHSREVLEQLVGPNKLKQVTWTVY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|