APrEST92202-100ul, PrEST Antigen ICE1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ICE1, Gene description: interactor of little elongation complex ELL subunit 1, Alternative Gene Names: KIAA0947, Antigen sequence: NKGSGTWEEKPKSHEAIQALNTWEVNKVTTSGLETFTATLRESSATHSLVGEKHWTTASRSMSDRKRDILHETKTQMEVREMDKSVQTEKTIH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ICE1, Gene description: interactor of little elongation complex ELL subunit 1, Alternative Gene Names: KIAA0947, Antigen sequence: NKGSGTWEEKPKSHEAIQALNTWEVNKVTTSGLETFTATLRESSATHSLVGEKHWTTASRSMSDRKRDILHETKTQMEVREMDKSVQTEKTIH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|