APrEST92136-100ul, PrEST Antigen SMARCD2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SMARCD2, Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2, Alternative Gene Names: BAF60B, CRACD2, PRO2451, Rsc6p, Antigen sequence: QYQRPGMSPGNRMPMAGLQVGPPAGSPFGAAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SMARCD2, Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2, Alternative Gene Names: BAF60B, CRACD2, PRO2451, Rsc6p, Antigen sequence: QYQRPGMSPGNRMPMAGLQVGPPAGSPFGAAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|